Germany
Japan
United Kingdom
China
LIX1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 224-254 amino acids from the C-terminal region of human LIX1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-LIX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIX1 antibody: synthetic peptide directed towards the N terminal of human LIX1. Synthetic peptide located within the following region: TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES |
LIX1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human LIX1 (NP_694966.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LIX1