Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Lamin B2 (LMNB2) (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 476-504 amino acids from the C-terminal region of Human Lamin B2. |
Rabbit Polyclonal Anti-LMNB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMNB2 antibody: synthetic peptide directed towards the N terminal of human LMNB2. Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE |
Rabbit Polyclonal Anti-LMNB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMNB2 antibody: synthetic peptide directed towards the middle region of human LMNB2. Synthetic peptide located within the following region: EVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM |
Carrier-free (BSA/glycerol-free) LMNB2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Lamin B2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 341-620 of human Lamin B2 (NP_116126.3). |
| Modifications | Unmodified |
Lamin B2 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LMNB2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LMNB2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LMNB2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LMNB2 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- LMNB2