Antibodies

Jump to Filters
View as table Download
Lmo1 Rabbit Polyclonal Antibody
TA329239

USD 375.00

5 Days

Rabbit Polyclonal anti-Lmo1 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Lmo1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Lmo1. Synthetic peptide located within the following region: NVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGHLNGTFESQVQ
LMO1 Rabbit Polyclonal Antibody
TA378087

USD 220.00

3 Weeks

LMO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human LMO1 (NP_002306.1).
Modifications Unmodified