Antibodies

Jump to Filters
View as table Download
LMOD1 Rabbit Polyclonal Antibody
AP18099PU-N

USD 450.00

2 Weeks

LMOD1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human LMOD
LMOD1 Rabbit Polyclonal Antibody
TA334435

USD 375.00

5 Days

Rabbit Polyclonal Anti-LMOD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMOD1 antibody: synthetic peptide directed towards the N terminal of human LMOD1. Synthetic peptide located within the following region: SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ
Lmod1 Rabbit Polyclonal Antibody
TA357198

USD 360.00

5 Days

Lmod1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated