Rabbit Polyclonal Anti-LONRF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the N terminal of human LONRF3. Synthetic peptide located within the following region: QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYN |
Rabbit Polyclonal Anti-LONRF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LONRF3 antibody: synthetic peptide directed towards the middle region of human LONRF3. Synthetic peptide located within the following region: LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG |
Carrier-free (BSA/glycerol-free) LONRF3 mouse monoclonal antibody,clone OTI9G7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LONRF3 mouse monoclonal antibody,clone OTI7F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LONRF3 mouse monoclonal antibody,clone OTI9G7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LONRF3 mouse monoclonal antibody,clone OTI9G7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
LONRF3 mouse monoclonal antibody,clone OTI9G7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LONRF3 mouse monoclonal antibody,clone OTI9G7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LONRF3 mouse monoclonal antibody,clone OTI7F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LONRF3 mouse monoclonal antibody,clone OTI7F7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
LONRF3 mouse monoclonal antibody,clone OTI7F7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
LONRF3 mouse monoclonal antibody,clone OTI7F7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China