Antibodies

Jump to Filters
View as table Download
LOXL3 Rabbit Polyclonal Antibody
TA342895

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-LOXL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LOXL3 antibody: synthetic peptide directed towards the middle region of human LOXL3. Synthetic peptide located within the following region: AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD
LOXL3 (C-term) Rabbit Polyclonal Antibody
AP52515PU-N

USD 450.00

2 Weeks

LOXL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 715-744 amino acids from the C-terminal region of human LOXL3
LOXL3 Rabbit Polyclonal Antibody
TA351362

USD 345.00

In Stock

Rabbit Polyclonal Anti-LOXL3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LOXL3