Antibodies

View as table Download

Rabbit Polyclonal Anti-LPA Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-LPA antibody: synthetic peptide directed towards the middle region of human LPA. Synthetic peptide located within the following region: SVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCY

Rabbit Polyclonal Anti-LPA Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-LPA antibody: synthetic peptide directed towards the N terminal of human LPA. Synthetic peptide located within the following region: VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS