Rabbit Monoclonal antibody against Apolipoprotein(a) (LPA)
Applications | IHC, WB |
Reactivities | Human |
Rabbit Monoclonal antibody against Apolipoprotein(a) (LPA)
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-LPA Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-LPA antibody: synthetic peptide directed towards the middle region of human LPA. Synthetic peptide located within the following region: SVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCY |
Rabbit Polyclonal Anti-LPA Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-LPA antibody: synthetic peptide directed towards the N terminal of human LPA. Synthetic peptide located within the following region: VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS |