Antibodies

View as table Download

LPAR6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPAR6

P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6

Rabbit Polyclonal Anti-LPAR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human LPAR6. Synthetic peptide located within the following region: VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR

Rabbit Polyclonal Anti-LPAR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the N-terminal region of Human LPAR6. Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK

Rabbit Polyclonal Anti-LPAR6 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Rat, Hamster, Rabbit (88%); Bat (81%).

Rabbit Polyclonal Anti-LPAR6 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Hamster, Elephant (100%); Monkey, Rat, Panda, Bovine, Rabbit (94%); Horse (88%).

LPAR6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPAR6