LPAR6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPAR6 |
LPAR6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPAR6 |
P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6 |
Rabbit Polyclonal Anti-LPAR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human LPAR6. Synthetic peptide located within the following region: VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR |
Rabbit Polyclonal Anti-LPAR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the N-terminal region of Human LPAR6. Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK |
Rabbit Polyclonal Anti-LPAR6 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Rat, Hamster, Rabbit (88%); Bat (81%). |
Rabbit Polyclonal Anti-LPAR6 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | LPAR6 / P2RY5 / P2Y5 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human LPAR6 / P2RY5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Hamster, Elephant (100%); Monkey, Rat, Panda, Bovine, Rabbit (94%); Horse (88%). |
LPAR6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPAR6 |