Germany
Japan
United Kingdom
China
Antibodies
View as table Download
LPCAT1 / AYTL2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Immunogen | LPCAT1 / AYTL2 antibody was raised against synthetic 14 amino acid peptide from internal region of human LPCAT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (93%). |
LPCAT1 / AYTL2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chicken, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat, Zebrafish |
| Immunogen | LPCAT1 / AYTL2 antibody was raised against synthetic 15 amino acid peptide from internal region of human LPCAT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Hamster, Pig, Opossum, Turkey, Chicken, Platypus, Zebrafish (100%); Bat, Bovine, Panda, Xenopus, Stickleback (93%); Pufferfish (87%); Horse (80%). |
Rabbit Polyclonal Anti-LPCAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LPCAT1 antibody: synthetic peptide directed towards the middle region of human LPCAT1. Synthetic peptide located within the following region: LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF |
LPCAT1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCAT1 |
LPCAT1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 325-534 of human LPCAT1 (NP_079106.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LPCAT1