Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LPIN1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LPIN1 Antibody: synthetic peptide directed towards the N terminal of human LPIN1. Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK |
Rabbit Polyclonal Antibody against LPIN1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide to an internal region (within residues 500-600) of the human LPIN1 protein. [Swiss-Prot# Q14693] |
Carrier-free (glycerol/BSA-free) LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LPIN1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human LPIN1 |
Lipin 1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 741-890 of human Lipin 1 (NP_663731.1). |
| Modifications | Unmodified |
Lipin 1 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Lipin 1 |
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- LPIN1