Antibodies

View as table Download

LRATD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LRATD1

Anti-ENO2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.6~10(I-W-A-R-E)derived from Human NSE.

Rabbit Polyclonal Anti-FAM84A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM84A antibody: synthetic peptide directed towards the N terminal of human FAM84A. Synthetic peptide located within the following region: GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD

LRATD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LRATD1