Antibodies

Jump to Filters
View as table Download
LRIT3 Mouse Monoclonal Antibody [Clone ID: 3E7]
AM21024PU-N

USD 480.00

2 Weeks

LRIT3 mouse monoclonal antibody, clone 3E7

Applications ELISA, IHC, WB
Reactivities Human
LRIT3 Rabbit Polyclonal Antibody
TA337414

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRIT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRIT3 antibody is: synthetic peptide directed towards the middle region of Human LRIT3. Synthetic peptide located within the following region: TVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLG