Antibodies

Jump to Filters
View as table Download
LRP2BP Rabbit Polyclonal Antibody
TA344154

USD 475.00

5 Days

Rabbit Polyclonal Anti-LRP2BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRP2BP antibody: synthetic peptide directed towards the middle region of human LRP2BP. Synthetic peptide located within the following region: RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE
Lrp2bp Rabbit Polyclonal Antibody
TA356197

USD 360.00

5 Days

Lrp2bp Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated