Antibodies

View as table Download

Rabbit Polyclonal anti-LRRC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC2 antibody: synthetic peptide directed towards the N terminal of human LRRC2. Synthetic peptide located within the following region: GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA

Rabbit Polyclonal anti-LRRC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC2 antibody: synthetic peptide directed towards the C terminal of human LRRC2. Synthetic peptide located within the following region: NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

LRRC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LRRC2

LRRC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LRRC2