Antibodies

View as table Download

Rabbit Polyclonal Anti-LRRC4C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC4C antibody: synthetic peptide directed towards the N terminal of human LRRC4C. Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE

LRRC4C Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-520 of human LRRC4C (NP_065980.1).
Modifications Unmodified