Rabbit Polyclonal Anti-LRRFIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRRFIP1 antibody: synthetic peptide directed towards the N terminal of human LRRFIP1. Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV |
Rabbit Polyclonal Anti-Lrrfip1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Lrrfip1 antibody is: synthetic peptide directed towards the middle region of Mouse Lrrfip1. Synthetic peptide located within the following region: IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD |
Lrrfip1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
LRRFIP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LRRFIP1 |
LRRFIP1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse LRRFIP1 |
LRRFIP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 589-808 of human LRRFIP1 (NP_001131024.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
