Antibodies

Jump to Filters
View as table Download
LSM8 Rabbit Polyclonal Antibody
TA343843

USD 475.00

5 Days

Rabbit Polyclonal Anti-LSM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM8 antibody: synthetic peptide directed towards the N terminal of human LSM8. Synthetic peptide located within the following region: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ
LSM8 Rabbit Polyclonal Antibody
TA378155

USD 220.00

3 Weeks

LSM8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human LSM8 (NP_057284.1).
Modifications Unmodified