Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-LSP1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSP1 |
LSP1 (261-275) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human |
| Immunogen | Peptide with sequence C-ASTKSRWETGEVQAQ, from the internal region of the protein sequence according to NP_002330.1; NP_001013271.1. |
Rabbit polyclonal anti-LSP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LSP1. |
Rabbit Polyclonal Anti-LSP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSP1 antibody: synthetic peptide directed towards the N terminal of human LSP1. Synthetic peptide located within the following region: CQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWS |
Mouse monoclonal Anti-LSP1 Clone TPD153
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti LSP (pS190) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus with a phosphorylated serine of human lymphocyte-specific protein 1. This sequence is identical to mouse species |
Rabbit anti LSP (Paired S190) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LSP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human lymphocyte-specific protein 1. This sequence is identical to mouse species |
LSP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LSP1 |
LSP1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LSP1 |
LSP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-339 of human LSP1 (NP_002330.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LSP1