Antibodies

Jump to Filters
View as table Download
LY6G6D Rabbit Polyclonal Antibody
TA333724

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-LY6G6D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LY6G6D Antibody is: synthetic peptide directed towards the N-terminal region of Human LY6G6D. Synthetic peptide located within the following region: LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT