Antibodies

Jump to Filters
View as table Download
LYPD6 Rabbit Polyclonal Antibody
TA337605

USD 375.00

5 Days

Rabbit Polyclonal Anti-LYPD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPD6 antibody: synthetic peptide directed towards the middle region of human LYPD6. Synthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS
LYPD6 Rabbit Polyclonal Antibody
TA357120

USD 360.00

5 Days

LYPD6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LYPD6