LYSMD4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 40-69 amino acids from the N-terminal region of human LYSMD4 |
LYSMD4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 40-69 amino acids from the N-terminal region of human LYSMD4 |
Rabbit Polyclonal Anti-LYSMD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYSMD4 antibody: synthetic peptide directed towards the N terminal of human LYSMD4. Synthetic peptide located within the following region: PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD |