Goat Polyclonal Anti-MKRN1 (aa105-118) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MKRN1 (aa105-118) Antibody: Peptide with sequence C-RYEHSKPLKQEEAT, from the internet regoin of the protein sequence according to NP_038474.2; NP_001138597.1. |
Rabbit Polyclonal LYVE-1 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the mouse LYVE1 protein sequence (between residues 250-318). [UniProt# Q8BHC0] |
Rat Anti-Mouse Lyve-1 Purified (25 ug)
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYVE1 Antibody: Peptide sequence around aa.271~275 (K-N-Q-Q-K) derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1. |
LYVE1 (271-275) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa.271~275 derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1 |
LYVE1 (271-275) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa.271~275 derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1 |
Rabbit Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYVE1 antibody: synthetic peptide directed towards the N terminal of human LYVE1. Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI5H3
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI8E10
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI5H6
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI5D11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI11C1
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-LYVE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-238 amino acids of human lymphatic vessel endothelial hyaluronan receptor 1 |
Anti-LYVE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-238 amino acids of human lymphatic vessel endothelial hyaluronan receptor 1 |
LYVE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-238 of human LYVE1 (NP_006682.2). |
| Modifications | Unmodified |
LYVE1 Rabbit monoclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
LYVE1 mouse monoclonal antibody,clone OTI5H3
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LYVE1 mouse monoclonal antibody,clone OTI5H3, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
LYVE1 mouse monoclonal antibody,clone OTI5H3, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
LYVE1 mouse monoclonal antibody,clone OTI5H3
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
LYVE1 mouse monoclonal antibody,clone OTI8E10
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LYVE1 mouse monoclonal antibody,clone OTI8E10, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
LYVE1 mouse monoclonal antibody,clone OTI8E10, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
LYVE1 mouse monoclonal antibody,clone OTI8E10
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
LYVE1 mouse monoclonal antibody,clone OTI5H6
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LYVE1 mouse monoclonal antibody,clone OTI5H6, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
LYVE1 mouse monoclonal antibody,clone OTI5H6, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
LYVE1 mouse monoclonal antibody,clone OTI5H6
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
LYVE1 mouse monoclonal antibody,clone OTI5D11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LYVE1 mouse monoclonal antibody,clone OTI5D11, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
LYVE1 mouse monoclonal antibody,clone OTI5D11, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
LYVE1 mouse monoclonal antibody,clone OTI5D11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
LYVE1 mouse monoclonal antibody,clone OTI11C1
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LYVE1 mouse monoclonal antibody,clone OTI11C1, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
LYVE1 mouse monoclonal antibody,clone OTI11C1, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
LYVE1 mouse monoclonal antibody,clone OTI11C1
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
