Germany
Japan
United Kingdom
China
LYZ rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Antibodies
View as table Download
LYZ rabbit polyclonal antibody, Biotin
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
LYZ rabbit polyclonal antibody, HRP
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
LYZ rabbit polyclonal antibody, FITC
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Human Lysozyme. |
Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Immunogen | Human Lysozyme. |
Lysozyme (LYZ) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Canine, Feline, Human, Monkey, Porcine |
| Immunogen | Human Lysozyme purified from the urine of patients with monocytic leukemia. |
LYZ rabbit polyclonal antibody, Serum
| Applications | IP |
| Reactivities | Human |
| Immunogen | Highly purified lysozyme is isolated from pooled milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Lysozyme Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LYZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the C terminal of human LYZ. Synthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG |
Rabbit Polyclonal Anti-LYZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the N terminal of human LYZ. Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL |
Rabbit anti Lysozyme Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | A synthetic peptide corresponding to the C-terminus 115-129aa of chicken egg white Lysozyme protein. |
Anti-LYZ Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme |
Lysozyme (LYZ) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1). |
| Modifications | Unmodified |
Lysozyme (LYZ) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-148 of human Lysozyme (Lysozyme (LYZ)) (NP_000230.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- LYZ