Antibodies

View as table Download

Rabbit Polyclonal Anti-LZTFL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LZTFL1 antibody: synthetic peptide directed towards the C terminal of human LZTFL1. Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Rabbit Polyclonal antibody to LZTFL1 (leucine zipper transcription factor-like 1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 269 of LZTFL1 (Uniprot ID#Q9NQ48)

Rabbit Polyclonal Anti-LZTFL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LZTFL1

LZTFL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of Human LZTFL1

LZTFL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LZTFL1

LZTFL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LZTFL1