Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LZTS2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LZTS2 antibody: synthetic peptide directed towards the N terminal of human LZTS2. Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL |
LZTS2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 571-601 amino acids from the C-terminal region of human LZTS2 |
Rabbit Polyclonal LZTS2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LZTS2 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human LZTS2. |
LZTS2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 470-669 of human LZTS2 (NP_115805.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LZTS2