Rabbit Polyclonal Anti-LAMP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT |
Rabbit polyclonal LAMP3 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LAMP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 8-38 amino acids from the N-terminal region of human LAMP3. |
Rabbit polyclonal anti-LAMP3 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMP3. |
Anti-LAMP3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 51-66 amino acids of Human lysosomal-associated membrane protein 3 |
Germany
Japan
United Kingdom
China
