Rabbit polyclonal anti-LDB2 antibody
| Applications | IHC, WB |
| Reactivities | Chimpanzee, Chicken, Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 107-120 of Mouse LDB2. |
Rabbit Polyclonal Anti-LDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the middle region of human LDB2. Synthetic peptide located within the following region: LENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQAS |
Rabbit Polyclonal Anti-LDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDB2 Antibody: synthetic peptide directed towards the N terminal of human LDB2. Synthetic peptide located within the following region: DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKES |
Rabbit Polyclonal Anti-LDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the C terminal of human LDB2. Synthetic peptide located within the following region: ENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ |
Ldb2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
LDB2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 204-373 of human LDB2 (NP_001281.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
