Antibodies

View as table Download

Rabbit Polyclonal Anti-LDB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDB3 antibody: synthetic peptide directed towards the N terminal of human LDB3. Synthetic peptide located within the following region: PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS

Goat Polyclonal Antibody against LDB3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KSQNKPEDEADE, from the internal region of the protein sequence according to NP_009009.1.

LDB3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-283 of human LDB3 (NP_001073585.1).
Modifications Unmodified