Antibodies

View as table Download

Goat Polyclonal Antibody against LDHC (aa 221 - 233)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DSDKEHWKNVHKQ, from the internal region of the protein sequence according to NP_002292.1; NP_059144.1.

Rabbit Polyclonal Anti-LDHC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHC Antibody: synthetic peptide directed towards the middle region of human LDHC. Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Goat Polyclonal Antibody against LDHC (aa 217 - 231)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLGTDSDKEHWKNIH, from the Internal region of the protein sequence according to NP_002292.1; NP_059144.1.

LDHC rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LDHC

LDHC rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LDHC

LDHC Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LDHC (NP_002292.1).
Modifications Unmodified