Antibodies

Jump to Filters
View as table Download
Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody
AP52467PU-N

USD 450.00

2 Weeks

Lunatic Fringe (LFNG) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 93~122 amino acids from the Central region of human LFNG
Lunatic Fringe (LFNG) Rabbit Polyclonal Antibody
TA314150

USD 345.00

4 Weeks

Rabbit polyclonal anti-LFNG antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human LFNG.
Lunatic Fringe (LFNG) Rabbit Polyclonal Antibody
TA335969

USD 375.00

5 Days

Rabbit Polyclonal Anti-LFNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LFNG Antibody: synthetic peptide directed towards the N terminal of human LFNG. Synthetic peptide located within the following region: LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK
LFNG Rabbit Polyclonal Antibody
TA366452

USD 380.00

4 Weeks

LFNG rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LFNG
Lunatic Fringe (LFNG) Rabbit Polyclonal Antibody
TA378000

USD 220.00

3 Weeks

LFNG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human LFNG (NP_002295.1).
Modifications Unmodified