Antibodies

View as table Download

LGALS4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS4

Rabbit polyclonal anti-LEG4 antibody

Applications IHC, WB
Reactivities WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:20000
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LEG4.

Rabbit Polyclonal Anti-Lgals4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS

GAL4 (LGALS4) mouse monoclonal antibody, clone 1E8, Purified

Applications ELISA, IHC, WB
Reactivities Human

GAL4 (LGALS4) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

GAL4 (LGALS4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 77-106 amino acids from the N-terminal region of Human Galectin-4

LGALS4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS4

Galectin 4/LGALS4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1).