Antibodies

View as table Download

Rabbit Polyclonal Anti-LEG7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LEG7 Antibody: A synthesized peptide derived from human LEG7

Rabbit polyclonal anti-LEG7 (Galectin-7) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LEG7.

Rabbit polyclonal anti-Galectin-7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human Galectin-7

Rabbit Polyclonal Anti-LGALS7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS7

LGALS7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated

LGALS7 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP