LGALS9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LGALS9 |
LGALS9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LGALS9 |
galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide from Human LEG9. Epitope: aa51-100 |
galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 51-100 of Human Galectin-9. |
Rabbit Polyclonal Anti-LEG9 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEG9 Antibody: A synthesized peptide derived from human LEG9 |
galectin 9 (LGALS9) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 61-90 amino acids from the N-terminal region of Human Galectin-9. |
Rabbit polyclonal anti-Galectin-9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 344 of human Galectin-9 |
Rabbit Polyclonal Anti-LGALS9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LGALS9 antibody is: synthetic peptide directed towards the middle region of Human LGALS9. Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV |
Rabbit Polyclonal Anti-LGALS9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LGALS9 antibody: synthetic peptide directed towards the middle region of human LGALS9. Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI21B5 (formerly 21B5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LGALS9 |
LGALS9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human LGALS9 (NP_002299.2). |
Modifications | Unmodified |
Recombinant Anti-Galectin 9 (Clone RG9-35)
Applications | Bl, FC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-Galectin 9 (Clone RG9-35)
Applications | Bl, FC |
Reactivities | Mouse |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI21B5 (formerly 21B5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI21B5 (formerly 21B5), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI21B5 (formerly 21B5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI21B5 (formerly 21B5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LGALS9 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |