Antibodies

View as table Download

LGALS9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS9

galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human LEG9.
Epitope: aa51-100

galectin 9 (LGALS9) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 51-100 of Human Galectin-9.

Rabbit Polyclonal Anti-LEG9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LEG9 Antibody: A synthesized peptide derived from human LEG9

galectin 9 (LGALS9) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 61-90 amino acids from the N-terminal region of Human Galectin-9.

Rabbit polyclonal anti-Galectin-9 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 344 of human Galectin-9

Rabbit Polyclonal Anti-LGALS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGALS9 antibody is: synthetic peptide directed towards the middle region of Human LGALS9. Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV

Rabbit Polyclonal Anti-LGALS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS9 antibody: synthetic peptide directed towards the middle region of human LGALS9. Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI8B11 (formerly 8B11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI21B5 (formerly 21B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS9 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS9

LGALS9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human LGALS9 (NP_002299.2).
Modifications Unmodified

Recombinant Anti-Galectin 9 (Clone RG9-35)

Applications Bl, FC
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-Galectin 9 (Clone RG9-35)

Applications Bl, FC
Reactivities Mouse
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI19F7 (formerly 19F7), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

LGALS9 mouse monoclonal antibody, clone OTI19H8 (formerly 19H8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)

Applications WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI16B4 (formerly 16B4)

Applications WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

LGALS9 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated