Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Anti-Human LMO2 Purified (25 ug)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-LMO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LMO2 antibody is: synthetic peptide directed towards the N-terminal region of Human LMO2. Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS |
Rabbit Polyclonal Anti-LMO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE |
Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Lmo2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
LMO2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1). |
| Modifications | Unmodified |
LMO2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1). |
| Modifications | Unmodified |
LMO2 Rabbit polyclonal Antibody
| Applications | FC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human LMO2 |
LMO2 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody,clone 2D7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LMO2 mouse monoclonal antibody,clone 2D7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- LMO2