Antibodies

View as table Download

Rabbit Polyclonal Anti-LMX1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LMX1B Antibody: A synthesized peptide derived from human LMX1B

Rabbit polyclonal anti-LMX1B antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LMX1B.

Rabbit Polyclonal LMX1B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal LMX1B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LMX1B.

LMX1B rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

Rabbit polyclonal anti-LMX1B antibody (CT)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal LMX1B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LMX1B.

Rabbit Polyclonal Anti-LMX1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LMX1B Antibody: synthetic peptide directed towards the C terminal of human LMX1B. Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS

LMX1B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1).
Modifications Unmodified

LMX1B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1).
Modifications Unmodified

LMX1B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 136-395 of human LMX1B (NP_002307.2).
Modifications Unmodified