Rabbit Polyclonal Anti-Loxl2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA |
LOXL2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 588-617 amino acids from the C-terminal region of Human LOXL2 |
Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%). |
Rabbit Polyclonal Anti-LOXL2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | LOXL2 antibody was raised against synthetic 17 amino acid peptide from internal region of human LOXL2. Percent identity with other species by BLAST analysis: Human, Marmoset (100%); Gorilla, Orangutan, Monkey, Bovine, Bat, Elephant (94%); Dog, Panda, Horse, Opossum (88%); Mouse, Rat, Turkey, Chicken, Platypus (82%). |
Rabbit Polyclonal Anti-LOXL2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LOXL2 antibody was raised against synthetic 20 amino acid peptide from internal region of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Guinea pig (100%); Bat (95%). |
Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LOXL2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human LOXL2 |
LOXL2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 505-774 of human LOXL2 (NP_002309.1). |
| Modifications | Unmodified |
LOXL2 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5), Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5), HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
