Antibodies

Jump to Filters
View as table Download
LRFN5 Rabbit Polyclonal Antibody
TA306744

USD 430.00

5 Days

Rabbit Polyclonal LRFN5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LRFN5 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human LRFN5.
LRFN5 Rabbit Polyclonal Antibody
TA338854

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRFN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRFN5 antibody: synthetic peptide directed towards the middle region of human LRFN5. Synthetic peptide located within the following region: PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV