Rabbit Polyclonal LRRC26 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LRRC26 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LRRC26. The immunogen is located within the last 50 amino acids of LRRC26. |
LRRC26 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 289-318 amino acids from the C-terminal region of human LRRC26 |
Rabbit Polyclonal Anti-LRRC26 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LRRC26 Antibody: synthetic peptide directed towards the middle region of human LRRC26. Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA |
Germany
Japan
United Kingdom
China
