LRRC6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 186-215 amino acids from the Central region of human LRRC6 |
LRRC6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 186-215 amino acids from the Central region of human LRRC6 |
Rabbit Polyclonal Anti-LRRC6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the N terminal of human LRRC6. Synthetic peptide located within the following region: LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL |
Rabbit Polyclonal Anti-LRRC6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the middle region of human LRRC6. Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) LRRC6 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI6D4 (formerly 6D4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRC6 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI2A8 (formerly 2A8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI2A8 (formerly 2A8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI6D4 (formerly 6D4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI6D4 (formerly 6D4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI6D4 (formerly 6D4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI6D4 (formerly 6D4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI7E9 (formerly 7E9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI7E9 (formerly 7E9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRC6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LRRC6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LRRC6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LRRC6 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |