Antibodies

Jump to Filters
View as table Download
LRRTM3 Rabbit Polyclonal Antibody
TA320177

USD 430.00

5 Days

Rabbit Polyclonal LRRTM3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LRRTM3 antibody was raised against a 18 amino acid synthetic peptide near the carboxy terminus of human LRRTM3.
LRRTM3 Rabbit Polyclonal Antibody
TA337745

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRRTM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRTM3 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRTM3. Synthetic peptide located within the following region: SLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGPCTYNK
LRRTM3 Rabbit Polyclonal Antibody
TA358927

USD 360.00

5 Days

LRRTM3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human LRRTM3