Antibodies

Jump to Filters
View as table Download
LYRM4 Rabbit Polyclonal Antibody
TA344783

USD 475.00

5 Days

Rabbit Polyclonal Anti-Lyrm4 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lyrm4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI
LYRM4 (Center) Rabbit Polyclonal Antibody
AP52570PU-N

USD 450.00

2 Weeks

LYRM4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 46-73 amino acids from the Central region of human LYRM4