Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Maf Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Maf Antibody: A synthesized peptide derived from human Maf |
Antibodies
View as table Download
Rabbit polyclonal anti-Maf antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Maf. |
Rabbit Polyclonal Anti-MAF Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAF antibody is: synthetic peptide directed towards the C-terminal region of Human MAF. Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK |
c Maf (MAF) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-MAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAF antibody: synthetic peptide directed towards the middle region of human MAF. Synthetic peptide located within the following region: LQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFI |
Rabbit Polyclonal Anti-MAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAF antibody: synthetic peptide directed towards the N terminal of human MAF. Synthetic peptide located within the following region: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI |
Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI2B12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI2G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI8F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAF mouse monoclonal antibody,clone OTI4H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAF Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MAF |
c-Maf Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). |
| Modifications | Unmodified |
c-Maf Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). |
| Modifications | Unmodified |
MAF mouse monoclonal antibody,clone OTI2B12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI2B12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI2B12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAF mouse monoclonal antibody,clone OTI2B12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAF mouse monoclonal antibody,clone OTI2G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI2G1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI2G1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAF mouse monoclonal antibody,clone OTI2G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAF mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI4E1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI4E1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAF mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAF mouse monoclonal antibody,clone OTI8F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI8F4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI8F4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAF mouse monoclonal antibody,clone OTI8F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAF mouse monoclonal antibody,clone OTI4H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI4H10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MAF mouse monoclonal antibody,clone OTI4H10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAF mouse monoclonal antibody,clone OTI4H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MAF