Rabbit Polyclonal Anti-Mafg Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mafg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mafg. Synthetic peptide located within the following region: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL |
Rabbit Polyclonal Anti-MAFG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFG antibody: synthetic peptide directed towards the middle region of human MAFG. Synthetic peptide located within the following region: KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART |
Rabbit Polyclonal Anti-MAFG Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAFG Antibody: synthetic peptide directed towards the N terminal of human MAFG. Synthetic peptide located within the following region: MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIV |
MAFG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-162 of human MAFG (NP_002350.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
