MAFK mouse monoclonal antibody, clone AT2F7, Purified
Applications | ELISA, WB |
Reactivities | Human |
MAFK mouse monoclonal antibody, clone AT2F7, Purified
Applications | ELISA, WB |
Reactivities | Human |
MAFK mouse monoclonal antibody, clone AT2F7, Purified
Applications | ELISA, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-MAFK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAFK antibody: synthetic peptide directed towards the N terminal of human MAFK. Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY |
Mafk Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |