Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-TAU Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TAU antibody was raised against a 19 amino acid peptide near the amino terminus of human TAU. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAGEA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA4 antibody: synthetic peptide directed towards the C terminal of human MAGEA4. Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP |
Anti-MAGEA4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
MAGEA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-317 of human MAGEA4 (NP_002353.3). |
| Modifications | Unmodified |
USD 509.00
5 Days
USD 509.00
In Stock
USD 420.00
5 Days
MAGEA4 mouse monoclonal antibody, clone OTI1F9
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 447.00
2 Weeks
MAGEA4 biotinylated mouse monoclonal antibody, clone OTI5E8
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MAGEA4