Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAGEB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEB2 antibody: synthetic peptide directed towards the N terminal of human MAGEB2. Synthetic peptide located within the following region: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA |
Rabbit Polyclonal Anti-MAGEB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEB2 antibody: synthetic peptide directed towards the N terminal of human MAGEB2. Synthetic peptide located within the following region: AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQ |
Carrier-free (BSA/glycerol-free) MAGEB2 mouse monoclonal antibody,clone OTI5C10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAGEB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAGEB2 |
MAGEB2 mouse monoclonal antibody,clone OTI5C10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAGEB2 mouse monoclonal antibody,clone OTI5C10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAGEB2 mouse monoclonal antibody,clone OTI5C10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAGEB2 mouse monoclonal antibody,clone OTI5C10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MAGEB2