Rabbit Polyclonal Anti-MAMLD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXorf6 Antibody: synthetic peptide directed towards the N terminal of human CXorf6. Synthetic peptide located within the following region: SPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPN |
Rabbit Polyclonal Anti-MAMLD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXORF6 Antibody: synthetic peptide directed towards the N terminal of human CXORF6. Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH |
MAMLD1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAMD1 |
Germany
Japan
United Kingdom
China