Germany
Japan
United Kingdom
China
USD 379.00
In Stock
Antibodies
View as table Download
USD 379.00
In Stock
Goat Polyclonal Antibody against Monoamine Oxidase A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1. |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE |
MAOA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAOA |
USD 380.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- MAOA