Rabbit polyclonal COT (Ab-290) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Rabbit polyclonal MAP3K8 (Ab-400) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D). |
Rabbit polyclonal MAP3K8 (Ser400) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D). |
| Modifications | Phospho-specific |
Rabbit Polyclonal COT Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human COT |
Rabbit Polyclonal COT (Thr290) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human COT around the phosphorylation site of Threonine 290 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-MAP3K8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the C terminal of human MAP3K8. Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY |
Rabbit Polyclonal anti-MAP3K8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the N terminal of human MAP3K8. Synthetic peptide located within the following region: ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL |
Rabbit Polyclonal Anti-MAP3K8 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MAP3K8 / TPL2 antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human MAP3K8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Elephant, Bovine, Dog, Bat (100%); Mouse, Rat, Hamster, Panda, Horse (94%). |
Rabbit Polyclonal Anti-MAP3K8 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MAP3K8 / TPL2 antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human MAP3K8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine (100%); Hamster, Panda, Bat, Dog (95%); Mouse, Rat, Rabbit, Pig (89%); Elephant, Horse, Platypus (84%). |
Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAP3K8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP3K8 (NP_005195.2). |
MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
