Germany
Japan
United Kingdom
China
Rabbit anti-JNK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human JNK2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
JNK2 (MAPK9) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Anti-MAPK9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9 |
JNK2 Rabbit monoclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
MAPK9 (JNK2) mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
5 Days
USD 420.00
5 Days
Active filters
Target Symbol
- MAPK9
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Pathways
- Adipocytokine signaling pathway (31)
- Colorectal cancer (31)
- Epithelial cell signaling in Helicobacter pylori infection (31)
- ErbB signaling pathway (31)
- Fc epsilon RI signaling pathway (31)
- Focal adhesion (31)
- GnRH signaling pathway (31)
- Insulin signaling pathway (31)
- MAPK signaling pathway (31)
- NOD-like receptor signaling pathway (31)
- Neurotrophin signaling pathway (31)
- Pancreatic cancer (31)
- Pathways in cancer (31)
- Progesterone-mediated oocyte maturation (31)
- RIG-I-like receptor signaling pathway (31)
- T cell receptor signaling pathway (31)
- Toll-like receptor signaling pathway (31)
- Type II diabetes mellitus (31)
- Wnt signaling pathway (31)